fayettevillefarmersmarketcny.com stats and valuation

Basic Information
Created 2013-12-26
Updated 2018-12-13
Expires 2019-12-26
Registrar Tucows Domains Inc.
Alexa Rank99999999
Backlinks0
Semrush Rank0
Domain Authority0/100
Pageviews11/ Day
Worth21.9
Last Updated:
Website Information
Title
Fayetteville Farmers Market CNY
Http Header
HTTP/1.1 200 OK
date: Fri, 17 May 2019 21:03:23 GMT
x-servedby: v6-site-56c6d8fdd8-tm8wd
strict-transport-security: max-age=0
expires: Thu, 01 Jan 1970 00:00:00 GMT
content-type: text/html; charset=UTF-8
x-pc-appver: 18016
x-pc-date: Fri, 17 May 2019 13:42:21 GMT
x-pc-host: 10.123.154.131
last-modified: Fri, 17 May 2019 21:03:24 GMT
etag: W/"f535c74fd3c78b5a6c804cdc838a13fa"
x-pc-key: HcR9qkSBmQzekEfHRTZ6zKc_vK8-lacey-cashman-xgtg
x-pc-hit: true
server: envoy
Vary: Accept-Encoding
Age: 0
X-Varnish: varnish-web004
Set-Cookie: crumb=BU+3zI6UysLWMWE3YTY2ODdkN2RkMjU0NjAzNjVlZWY4MzEyNGRi;Path=/
Accept-Ranges: bytes
Transfer-Encoding: chunked
x-contextid: ox4Zp6d2/YgVoV4Tq
x-via: 1.1 echo013
SSL Provider
Let's Encrypt
Semrush Metrics
No Data available

View Full Report

DNS Report
HostTypeClassTTLExtra
fayettevillefarmersmarketcny.comHINFOIN3600cpu: ANY not supported.
os: See draft-ietf-dnsop-refuse-any
fayettevillefarmersmarketcny.comNSIN172800target: dns3.p08.nsone.net
fayettevillefarmersmarketcny.comNSIN172800target: dns2.p08.nsone.net
fayettevillefarmersmarketcny.comNSIN172800target: dns1.p08.nsone.net
fayettevillefarmersmarketcny.comNSIN172800target: dns4.p08.nsone.net
IP Address Information
Server IP
198.185.159.144
Server Location
New York,NY,United States
ISP
Squarespace
Location on MAP
Domain Whois Record
	     Domain Name: FAYETTEVILLEFARMERSMARKETCNY.COM
   Registry Domain ID: 1840427250_DOMAIN_COM-VRSN
   Registrar WHOIS Server: whois.tucows.com
   Registrar URL: http://www.tucows.com
   Updated Date: 2018-12-13T02:22:17Z
   Creation Date: 2013-12-26T15:52:11Z
   Registry Expiry Date: 2019-12-26T15:52:11Z
   Registrar: Tucows Domains Inc.
   Registrar IANA ID: 69
   Registrar Abuse Contact Email:
   Registrar Abuse Contact Phone:
   Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
   Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
   Name Server: DNS1.P08.NSONE.NET
   Name Server: DNS2.P08.NSONE.NET
   Name Server: DNS3.P08.NSONE.NET
   Name Server: DNS4.P08.NSONE.NET
   DNSSEC: unsigned
   URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-05-17T21:03:17Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar.  Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.

IP Address: 173.208.201.146
Maximum Daily connection limit reached. Lookup refused.	  

Analyze Another Website

Semrush 14 days trial

Recently Viewed