[Querying whois.publicinterestregistry.net]
[whois.publicinterestregistry.net]
Domain Name: SRISUBRAHMANYASWAMYDEVALAYAMSKANDAGIRI.ORG
Registry Domain ID: D162151921-LROR
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: http://www.publicdomainregistry.com
Updated Date: 2018-04-18T09:37:32Z
Creation Date: 2011-04-29T14:24:28Z
Registry Expiry Date: 2019-04-29T14:24:28Z
Registrar Registration Expiration Date:
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Registrar Abuse Contact Email: abuse-contact@publicdomainregistry.com
Registrar Abuse Contact Phone: +1.2013775952
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: C137364795-LROR
Registrant Name: Outline Designs
Registrant Organization: Outline Designs
Registrant Street: Flat No: 608, taj enclave
Registrant Street: Lakdikapool
Registrant City: Hyderabad
Registrant State/Province: Andhra Pradesh
Registrant Postal Code: 500004
Registrant Country: IN
Registrant Phone: +91.04064538777
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: info@outlinedesigns.in
Registry Admin ID: C137364795-LROR
Admin Name: Outline Designs
Admin Organization: Outline Designs
Admin Street: Flat No: 608, taj enclave
Admin Street: Lakdikapool
Admin City: Hyderabad
Admin State/Province: Andhra Pradesh
Admin Postal Code: 500004
Admin Country: IN
Admin Phone: +91.04064538777
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: info@outlinedesigns.in
Registry Tech ID: C137364795-LROR
Tech Name: Outline Designs
Tech Organization: Outline Designs
Tech Street: Flat No: 608, taj enclave
Tech Street: Lakdikapool
Tech City: Hyderabad
Tech State/Province: Andhra Pradesh
Tech Postal Code: 500004
Tech Country: IN
Tech Phone: +91.04064538777
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: info@outlinedesigns.in
Name Server: NS1.OUTLINE.CO.IN
Name Server: NS2.OUTLINE.CO.IN
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2018-05-04T09:30:31Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
Access to Public Interest Registry WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the Public Interest Registry registry database. The data in this record is provided by Public Interest Registry for informational purposes only, and Public Interest Registry does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. Public Interest Registry reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.