kansascitycriminaldefenselawyer.com stats and valuation

Basic Information
Created 2009-02-04
Updated 2020-01-15
Expires 2021-02-04
Owner WhoisGuard, Inc.
Registrar NAMECHEAP INC
Alexa Rank99999999
Backlinks0
Semrush Rank6634750
Domain Authority0/100
Pageviews11/ Day
Worth21.9
Last Updated:
Website Information
Title
Kansas City Criminal Defense Lawyer
Http Header
HTTP/1.1 200 OK
Date: Sun, 17 May 2020 16:54:49 GMT
Server: Apache
X-UA-Compatible: IE=EmulateIE7
X-Powered-By: W3 Total Cache/0.9.5.4
X-Pingback: http://www.kansascitycriminaldefenselawyer.com/xmlrpc.php
Link: <http://www.kansascitycriminaldefenselawyer.com/wp-json/>; rel="https://api.w.org/", <http://www.kansascitycriminaldefenselawyer.com/>; rel=shortlink
Set-Cookie: adinj=1; expires=Sun, 17-May-2020 17:54:49 GMT; Max-Age=3600; path=/
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding
Content-Length: 22758
Content-Type: text/html; charset=UTF-8
SSL Provider
Semrush Metrics
Semrush Rank6634750Rank based on keywords, cost and organic traffic
Keywords125Number of keywords in top 20 Google SERP
Organic Traffic31Number of visitors coming from top 20 search results
Cost (in USD)28$How much need to spend if get same number of visitors from Google Adwords
Adwords Keyword0Keywords a website is buying in Google AdWords for ads that appear in paid search results.
Adwords Traffic0Number of visitors brought to the website via paid search results.
Adwords budget (in USD)0$Estimated budget spent for buying keywords in Google AdWords for ads that appear in paid search results (monthly estimation).

View Full Report

DNS Report
HostTypeClassTTLExtra
kansascitycriminaldefenselawyer.comAIN900ip: 192.158.238.29
kansascitycriminaldefenselawyer.comSOAIN86400mname: ns5.wznoc.com
rname: davematson.gmail.com
serial: 2019050402
refresh: 86400
retry: 7200
expire: 3600000
minimum-ttl: 86400
kansascitycriminaldefenselawyer.comMXIN900pri: 0
target: kansascitycriminaldefenselawyer.com
kansascitycriminaldefenselawyer.comNSIN86400target: ns5.wznoc.com
kansascitycriminaldefenselawyer.comNSIN86400target: ns6.wznoc.com
IP Address Information
Server IP
192.158.238.29
Server Location
Indialantic,FL,United States
ISP
Vivid Hosting
Location on MAP
Domain Whois Record
	     Domain Name: KANSASCITYCRIMINALDEFENSELAWYER.COM
   Registry Domain ID: 1540674078_DOMAIN_COM-VRSN
   Registrar WHOIS Server: whois.namecheap.com
   Registrar URL: http://www.namecheap.com
   Updated Date: 2020-01-15T15:00:59Z
   Creation Date: 2009-02-03T19:31:15Z
   Registry Expiry Date: 2021-02-03T19:31:15Z
   Registrar: NameCheap, Inc.
   Registrar IANA ID: 1068
   Registrar Abuse Contact Email: abuse@namecheap.com
   Registrar Abuse Contact Phone: +1.6613102107
   Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
   Name Server: NS1.YOURSOFTDNS4.COM
   Name Server: NS2.YOURSOFTDNS4.COM
   DNSSEC: unsigned
   URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-05-17T16:54:21Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar.  Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.

Domain name: kansascitycriminaldefenselawyer.com
Registry Domain ID: 1540674078_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2020-01-15T15:00:59.82Z
Creation Date: 2009-02-03T19:31:15.00Z
Registrar Registration Expiration Date: 2021-02-03T19:31:15.00Z
Registrar: NAMECHEAP INC
Registrar IANA ID: 1068
Registrar Abuse Contact Email: abuse@namecheap.com
Registrar Abuse Contact Phone: +1.6613102107
Reseller: NAMECHEAP INC
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: WhoisGuard Protected
Registrant Organization: WhoisGuard, Inc.
Registrant Street: P.O. Box 0823-03411
Registrant City: Panama
Registrant State/Province: Panama
Registrant Postal Code:
Registrant Country: PA
Registrant Phone: +507.8365503
Registrant Phone Ext:
Registrant Fax: +51.17057182
Registrant Fax Ext:
Registrant Email: c0cc723f873545b0b103f920a80e14ab.protect@whoisguard.com
Registry Admin ID:
Admin Name: WhoisGuard Protected
Admin Organization: WhoisGuard, Inc.
Admin Street: P.O. Box 0823-03411
Admin City: Panama
Admin State/Province: Panama
Admin Postal Code:
Admin Country: PA
Admin Phone: +507.8365503
Admin Phone Ext:
Admin Fax: +51.17057182
Admin Fax Ext:
Admin Email: c0cc723f873545b0b103f920a80e14ab.protect@whoisguard.com
Registry Tech ID:
Tech Name: WhoisGuard Protected
Tech Organization: WhoisGuard, Inc.
Tech Street: P.O. Box 0823-03411
Tech City: Panama
Tech State/Province: Panama
Tech Postal Code:
Tech Country: PA
Tech Phone: +507.8365503
Tech Phone Ext:
Tech Fax: +51.17057182
Tech Fax Ext:
Tech Email: c0cc723f873545b0b103f920a80e14ab.protect@whoisguard.com
Name Server: ns1.yoursoftdns4.com
Name Server: ns2.yoursoftdns4.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-05-16T18:54:48.03Z <<<

For more information on Whois status codes, please visit https://icann.org/epp